PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_111750_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 113aa    MW: 13492.1 Da    PI: 10.6929
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_111750_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding36.98.2e-1261100344
                                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
                       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                                            W++eE  ++++a +++G++ Wk++a+ +  +R  +++ks +
  cra_locus_111750_iso_1_len_339_ver_3  61 QWSEEELRRFYEAYREHGKD-WKKVAAVLR-NRPVEMVKSLY 100
                                           7*****************99.*********.********966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.04857108IPR017884SANT domain
SMARTSM007172.8E-758106IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-1259107IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-76099IPR009057Homeodomain-like
PfamPF002491.3E-1061101IPR001005SANT/Myb domain
CDDcd001672.81E-762104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 113 aa     Download sequence    Send to blast
XSTRFFSFRT FSSIWMVMRP ARKSRSVNKW NDYVSEVSPV KDVDSPKGND RRKRKLSDTT  60
QWSEEELRRF YEAYREHGKD WKKVAAVLRN RPVEMVKSLY TMNKAYLSLP EGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14955DRRKRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667784.15e-35PREDICTED: protein ALWAYS EARLY 3 isoform X1
RefseqXP_010667785.15e-35PREDICTED: protein ALWAYS EARLY 3 isoform X2
RefseqXP_010667786.15e-35PREDICTED: protein ALWAYS EARLY 3 isoform X3
RefseqXP_010667787.15e-35PREDICTED: protein ALWAYS EARLY 3 isoform X4
SwissprotQ6A3326e-26ALY3_ARATH; Protein ALWAYS EARLY 3
TrEMBLA0A0K9RZQ32e-36A0A0K9RZQ3_SPIOL; Uncharacterized protein
TrEMBLA0A0K9S1C32e-36A0A0K9S1C3_SPIOL; Uncharacterized protein
STRINGVIT_05s0020g01610.t013e-34(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1589944